Passa al contenuto
Merck
Tutte le immagini(1)

Documenti

MSQC2

Sigma-Aldrich

MS QCAL Peptide Mix

lyophilized powder

Sinonimo/i:

MS Qual/Quant QC Mix, universal MS platform standard

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352200
NACRES:
NA.24

Forma fisica

lyophilized powder

Classi chimiche degli analiti

amino acids, peptides, proteins

tecniche

HPLC: suitable

applicazioni

food and beverages

Formato

multi-component solution

Condizioni di spedizione

ambient

Temperatura di conservazione

2-8°C

Cerchi prodotti simili? Visita Guida al confronto tra prodotti

Descrizione generale

QCAL was designed using the QconCAT technology and recombinantly expressed in E. coli.  The parent protein sequence of QCAL is as follows:

MGALRVFDEFKPLVEEPQNLIRVFDEFKPLVKPEEPQNLIRVFDEFKPLVKPEEKPQNLIRVFDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIKPRVFDEFQPLVEEPQNLIRGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGVNDNEEGFFSAKGGGVNDNEEGFFSARAVMDDFAAFVEKAVMMDDFAAFVEKAVMMMDDFAAFVEKGLVKFVVPRALELFRIGDYAGIKEALDFFARYLGYLEQLLRVLYPNDNFFEGKLFTFHADICTLPDTEKALVALVLVPRGSLEVLFQGPIEGRTENLYFQGDDDDKALVALVHHHHHH

QCAL was subsequently digested with trypsin to give a core mixture of 22 peptides.

Applicazioni

This product is optimized to assess platform characteristics, including:
  • Repeatability/Reproducibility between runs
  • System stability (drift, chromatography, signal intensity, sensitivity, etc.)
  • Inter- and intra- platform and lab comparisons
MSQC2 is intended to act as a universal MS platform standard, by providing several elements for calibration and performance assessment, such as instrument resolution and linearity of signal detection.

Caratteristiche e vantaggi

General

Complexity
  • Defined mixture gives confidence in your instruments analysis

Componenti

Each vial contains 25 μg of lyophilized peptides that are derived from trypsin digestion of the protein concatamer QCAL.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Claire E Eyers et al.
Journal of the American Society for Mass Spectrometry, 19(9), 1275-1280 (2008-07-05)
If proteome datasets are to be collated, shared, and merged for higher level proteome analyses, there is a need for generally accepted strategies and reagents for optimization and standardization of instrument performance. At present, there is no single protein or
Julie M Pratt et al.
Nature protocols, 1(2), 1029-1043 (2007-04-05)
An important area of proteomics involves the need for quantification, whether relative or absolute. Many methods now exist for relative quantification, but to support biomarker proteomics and systems biology, absolute quantification rather than relative quantification is required. Absolute quantification usually

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.