Skip to Content
Merck
All Photos(5)

Key Documents

WH0006789M1

Sigma-Aldrich

Monoclonal Anti-STK4 antibody produced in mouse

clone 1D7-8A10, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-DKFZp686A2068, Anti-KRS2, Anti-MST1, Anti-serine/threonine kinase 4

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
€489.00

€489.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μG
€489.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€489.00


Please contact Customer Service for Availability

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1D7-8A10, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... STK4(6789)

General description

The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it′s possible that this protein induces the chromatin condensation observed in this process. (provided by RefSeq)

Immunogen

STK4 (AAH05231, 1 a.a. ~ 39 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEG

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Maria Chatzifrangkeskou et al.
The EMBO journal, 38(16), e101168-e101168 (2019-08-16)
Nuclear actin participates in many essential cellular processes including gene transcription, chromatin remodelling and mRNA processing. Actin shuttles into and out the nucleus through the action of dedicated transport receptors importin-9 and exportin-6, but how this transport is regulated remains

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service