We tested this antibody using 1 ug/ml and 2 ug/ml concentration in western blot and it did not work for protein extracted from human cells (HepG2), mouse cells (AML12) and male & female C57BL/6 mice liver. We used GAPDH as loading control and it worked perfectly, giving clear bands in those samples. However, no band was detected for USP30 using this antibody even at 2 ug/ml i.e 1:250 dilution of the antibody. This is a complete waste of money and the product should have been well validated before sale.
SAB2109073
Anti-USP30 antibody produced in rabbit
Anti-USP30 antibody produced in rabbit
1 of 1 reviewers received a sample product or took part in a promotion
affinity isolated antibody
Synonym(s):
FLJ40511, MGC10702
Sign Into View Organizational & Contract Pricing
Select a Size
100 μL
€326.00
€326.00
Please contact Customer Service for Availability
All Photos(2)
Select a Size
Change View
100 μL
€326.00
About This Item
UNSPSC Code:
12352203
NACRES:
NA.43
€326.00
Please contact Customer Service for Availability
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
57 kDa
species reactivity (predicted by homology)
canine, rabbit, horse, human, bovine, rat, guinea pig, mouse
concentration
0.5 mg/mL
technique(s)
western blot: 1 μg/mL
NCBI accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... USP30(57396)
General description
USP30, a member of the ubiquitin-specific protease family (see USP1, MIM 603478), is a novel mitochondrial deubiquitinating (DUB) enzyme (Nakamura and Hirose, 2008 [PubMed 18287522]).
Immunogen
Synthetic peptide directed towards the middle region of human USP30
Sequence
Synthetic peptide located within the following region: SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH
Physical form
Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
nwg
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.
If you need assistance, please contact Customer Support.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
