Skip to Content
Merck
All Photos(2)

Key Documents

SAB2107648

Sigma-Aldrich

Anti-DNASE1L3 antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€489.00

€489.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€489.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€489.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

34 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DNASE1L3(1776)

Related Categories

General description

DNASE1L3 (Deoxyribonuclease I-like 3) is a 32kDa endonuclease protein expressed in the spleen, liver, thymus, lymph node, bone marrow, small intestine and kidney. It consists of an N-terminal signal peptide responsible for the rER (rough endoplasmic reticulum) transport.

Immunogen

The immunogen for anti-DNASE1L3 antibody: synthetic peptide derected towards the C terminal of human DNASE1L3

Application

Anti-DNASE1L3 antibody produced in rabbit is suitable for western blot and indirect ELISA.

Biochem/physiol Actions

DNASE1L3 (Deoxyribonuclease I-like 3) is involved in residual nuclease activity of internucleosomal chromatin. In presence of Ca2+/Mg2+, it produces 3′-OH/5′-P ends by cleaving both the DNA strand, double-stranded and single-stranded DNA molecule. It has also been reported that DNASE1L3 may cleave apoptotic DNA of thymocytes, neuronal PC12 cells, C2C12 myoblasts and of cell lines expressing the recombinant nuclease. Mutation in DNASE1L3 causes a rare syndrome, hypocomplementemic urticarial vasculitis syndrome (HUVS).

Sequence

Synthetic peptide located within the following region: DFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Z Birsin Ozçakar et al.
Arthritis and rheumatism, 65(8), 2183-2189 (2013-05-15)
Hypocomplementemic urticarial vasculitis syndrome (HUVS) is characterized by recurrent urticaria along with dermal vasculitis, arthritis, and glomerulonephritis. Systemic lupus erythematosus (SLE) develops in >50% of patients with HUVS, although the pathogenesis is unknown. The aim of this study was to
Markus Napirei et al.
The Biochemical journal, 389(Pt 2), 355-364 (2005-03-31)
Deoxyribonuclease 1 (DNASE1, DNase I) and deoxyribonuclease 1-like 3 (DNASE1L3, DNase gamma, DNase Y, LS-DNase) are members of a DNASE1 protein family that is defined by similar biochemical properties such as Ca2+/Mg2+-dependency and an optimal pH of about 7.0 as

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service