Skip to Content
Merck
All Photos(1)

Documents

SAB2107546

Sigma-Aldrich

Anti-IMMP2L antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

20 kDa

species reactivity

guinea pig, mouse, human, bovine, rat, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... IMMP2L(83943)

General description

Inner mitochondrial membrane peptidase subunit 2 (IMMP2L) is a 175 amino acid protein. The gene encoding it is localized on human chromosome 7q31 and spans around 860kb. The gene is expressed in many tissues.

Immunogen

Synthetic peptide directed towards the N terminal region of human IMMP2L

Biochem/physiol Actions

Inner mitochondrial membrane peptidase subunit 2 (IMMP2L) modulates reactive oxygen species levels in the mitochondria. It may be associated with Tourette syndrome.

Sequence

Synthetic peptide located within the following region: LNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Disruption of a novel gene (IMMP2L) by a breakpoint in 7q31 associated with Tourette syndrome.
Petek E
American Journal of Human Genetics, 68(4), 848-858 (2001)
R A Clarke et al.
Translational psychiatry, 2, e158-e158 (2012-09-06)
Tourette syndrome (TS) is a highly heritable neuropsychiatric disorder characterised by motor and vocal tics. Despite decades of research, the aetiology of TS has remained elusive. Recent successes in gene discovery backed by rapidly advancing genomic technologies have given us
Birgitte Bertelsen et al.
European journal of human genetics : EJHG, 22(11), 1283-1289 (2014-02-20)
Tourette syndrome is a neurodevelopmental disorder characterized by multiple motor and vocal tics, and the disorder is often accompanied by comorbidities such as attention-deficit hyperactivity-disorder and obsessive compulsive disorder. Tourette syndrome has a complex etiology, but the underlying environmental and

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service