Skip to Content
Merck
All Photos(1)

Key Documents

SAB2100135

Sigma-Aldrich

Anti-Amyloid Precursor Protein (APP) Antibody

rabbit polyclonal

Synonym(s):

Anti-Aβ, Anti-AAA, Anti-ABPP, Anti-AD1, Anti-Amyloid β (A4) precursor protein (peptidase nexin-II, Alzheimer disease)

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€454.00

€454.00


Please contact Customer Service for Availability
A recombinant, preservative-free antibody is available for your target. Try ZRB1151


Select a Size

Change View
100 μL
€454.00

About This Item

CAS Number:
MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

€454.00


Please contact Customer Service for Availability
A recombinant, preservative-free antibody is available for your target. Try ZRB1151

Product Name

Anti-APP (ab2) antibody produced in rabbit, affinity isolated antibody

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

77 kDa

species reactivity

human, bovine, guinea pig, rabbit, rat, dog, mouse, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... APP(351)

Immunogen

Synthetic peptide directed towards the middle region of human APP

Biochem/physiol Actions

APP is a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.

Sequence

Synthetic peptide located within the following region: EAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAAN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service