Skip to Content
Merck
All Photos(1)

Key Documents

AV54415

Sigma-Aldrich

Anti-C9ORF117 antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€374.00

€374.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€374.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€374.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

60 kDa

species reactivity

guinea pig, bovine, human, horse, rat, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

C9ORF117 (chromosome 9 open reading frame 117) gene encodes a protein located on to 9q34.11. It is a target gene for hsa-miR-151a-3p and was used to examine the association of human diseases with the predicted target genes. Expression of C9ORF117 gene was used to study the mechanisms of respiratory sensitization.

Immunogen

Synthetic peptide directed towards the N terminal region of human C9orf117

Application

Anti-C9ORF117 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Sequence

Synthetic peptide located within the following region: LAKEMEKDAFEAQLAQVRHEFQETKDQLTTENIILGGKLAALEEFRLQKE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Alan Lap-Yin Pang et al.
Oncology letters, 7(6), 1819-1825 (2014-06-17)
MicroRNAs (miRNAs) are small non-coding RNAs that regulate the expression of their target genes at the post-transcriptional level. In cancer cells, miRNAs, depending on the biological functions of their target genes, may have a tumor-promoting or -suppressing effect. Treatment of
Sandra Verstraelen et al.
Toxicology, 255(3), 151-159 (2008-12-02)
Respiratory sensitization is a concern for occupational and environmental health in consumer product development. Despite international regulatory requirements there is no established protocol for the identification of chemical respiratory sensitizers. New tests should be based on mechanistic understanding and should
S J Humphray et al.
Nature, 429(6990), 369-374 (2004-05-28)
Chromosome 9 is highly structurally polymorphic. It contains the largest autosomal block of heterochromatin, which is heteromorphic in 6-8% of humans, whereas pericentric inversions occur in more than 1% of the population. The finished euchromatic sequence of chromosome 9 comprises

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service