Skip to Content
Merck
All Photos(1)

Key Documents

AV54366

Sigma-Aldrich

Anti-IMPDH2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-IMP (inosine monophosphate) dehydrogenase 2, Anti-IMPD2, Anti-IMPDH-II

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Pricing and availability is not currently available.

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

56 kDa

species reactivity

guinea pig, rabbit, bovine, horse, mouse, rat, human, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IMPDH2(3615)

Immunogen

Synthetic peptide directed towards the C terminal region of human IMPDH2

Application

Anti-IMPDH2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

IMPDH2 gene encodes the rate-limiting enzyme inosine monophosphate dehydrogenase 2. It consists of 14 exons and is approximately 5.8kb in length. It is localised in the cytoplasm and nucleus. It plays a pivotal role in catalysing the NAD-dependent oxidation of inosine-5′-monophosphate into xanthine-5′-monophosphate, later converted to guanosine-5′-monophosphate. A novel non-genotoxic p53 activator Inauzhin (INZ) inhibits cellular activity of IMPDH2, which in turn reduces the levels of cellular GTP and GTP-binding nucleostemin. INZ also induces the ribosomal stress (RS)-p53 pathway and RPL11/RPL5-MDM2 interaction and activates p53 and inhibits cancer cell growth.

Sequence

Synthetic peptide located within the following region: SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Sakibul Huq et al.
Molecular cancer therapeutics, 19(9), 1797-1808 (2020-07-02)
Nasopharyngeal carcinoma (NPC) is a squamous cell carcinoma with a proclivity for systemic dissemination, leading many patients to present with advanced stage disease and fail available treatments. There is a notable lack of targeted therapies for NPC, despite working knowledge
Qi Zhang et al.
eLife, 3, doi:10-doi:10 (2014-10-28)
The 'ribosomal stress (RS)-p53 pathway' is triggered by any stressor or genetic alteration that disrupts ribosomal biogenesis, and mediated by several ribosomal proteins (RPs), such as RPL11 and RPL5, which inhibit MDM2 and activate p53. Inosine monophosphate (IMP) dehydrogenase 2
A G Zimmermann et al.
The Journal of biological chemistry, 270(12), 6808-6814 (1995-03-24)
Inosine-5'-monophosphate dehydrogenase (IMPDH) activity and mRNA levels are induced up to 15-fold upon mitogenic or antigenic stimulation of human peripheral blood T lymphocytes. This increase in IMPDH activity is required for cellular proliferation and has been associated with malignant transformation.
Jeremy E McLean et al.
The Biochemical journal, 379(Pt 2), 243-251 (2004-02-10)
Inosine 5'-monophosphate dehydrogenase (IMPDH) is the rate-limiting enzyme in the de novo biosynthesis of guanine nucleotides. In addition to the catalytic domain, IMPDH contains a subdomain of unknown function composed of two cystathione beta-synthase domains. Our results, using three different

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service