SAB1411347

Anti-TSPO antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Synonym(s): BZRP, DBI, IBP, MBR, PBR, PKBS, PTBR, mDRC, pk18
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen 18.8 kDa
• species reactivity: human
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: BC001110.2
• UniProt accession no.: P30536
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TSPO(706)

Description

General description

Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)

Immunogen

TSPO (AAH01110.1, 1 a.a. ~ 169 a.a) full-length human protein.

Sequence
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable