Skip to Content
Merck
All Photos(1)

Key Documents

AV49908

Sigma-Aldrich

Anti-ELOVL7 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-ELOVL family member 7, elongation of long chain fatty acids (yeast), Anti-FLJ23563

Sign Into View Organizational & Contract Pricing
All Photos(1)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

33 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

NP_079206

UniProt accession no.

A1L3X0

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ELOVL7(79993)

Related Categories

General description

ELOVL7 (Elongation of very long chain fatty acids protein-7) is widely expressed, except for heart and skeletal muscle tissues. It belongs to ELOVL family of proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human ELOVL7

Application

Anti-ELOVL7 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Biochem/physiol Actions

Elongation of very long chain fatty acids protein-7 (ELOVL7) is a very long-chain fatty acid elongase with high activity towards acyl-CoA. It plays an important role in lipid metabolism of prostate cancer cells and might be the link between fat dietary intake and carcinogenesis.

Sequence

Synthetic peptide located within the following region: MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Sylwia Hasterok et al.
Molecular cancer research : MCR, 21(12), 1329-1341 (2023-09-12)
The clinical success of combined androgen deprivation therapy (ADT) and radiotherapy (RT) in prostate cancer created interest in understanding the mechanistic links between androgen receptor (AR) signaling and the DNA damage response (DDR). Convergent data have led to a model
Yusuke Ohno et al.
Proceedings of the National Academy of Sciences of the United States of America, 107(43), 18439-18444 (2010-10-13)
Very long-chain fatty acids (VLCFAs) exert a variety of cellular functions and are associated with numerous diseases. However, the precise pathway behind their elongation has remained elusive. Moreover, few regulatory mechanisms for VLCFAs synthesis have been identified. Elongases catalyze the
Tatsuro Naganuma et al.
FEBS letters, 585(20), 3337-3341 (2011-10-01)
Very long-chain fatty acids (VLCFAs) have a variety of physiological functions and are related to numerous disorders. The key step of VLCFA elongation is catalyzed by members of the elongase family, ELOVLs. Mammals have seven ELOVLs (ELOVL1-7), yet none of
Kenji Tamura et al.
Cancer research, 69(20), 8133-8140 (2009-10-15)
A number of epidemiologic studies have indicated a strong association between dietary fat intake and prostate cancer development, suggesting that lipid metabolism plays some important roles in prostate carcinogenesis and its progression. In this study, through our genome-wide gene expression

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service