Skip to Content
Merck
All Photos(2)

Key Documents

AV43930

Sigma-Aldrich

Anti-SLC7A8 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-LAT2, Anti-LPI-PC1, Anti-Solute carrier family 7 (cationic amino acid transporter, y+ system), member 8

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

37 kDa

species reactivity

guinea pig, human, mouse, rat, bovine, rabbit, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SLC7A8(23428)

Related Categories

Immunogen

Synthetic peptide directed towards the middle region of human SLC7A8

Application

Anti-SLC7A8 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Biochem/physiol Actions

SLC7A8 also referred to as LAT2 is an L-type neutral amino acid transporter present in the epithelium of kidney proximal tubules and the digestive tract. LAT2 preferentially selects branched-chain amino acids as substrates and transports them across membranes. It has been reported that LAT2 activates the pathway mediated by mammalian target of rapamycin complex 1 (mTORC1) in the glomerular epithelial cells and has a role in the pathogenesis of crescentic glomerulonephritis.

Sequence

Synthetic peptide located within the following region: PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jonas Zaugg et al.
Journal of cellular and molecular medicine, 24(21), 12681-12693 (2020-10-02)
The placenta supplies the foetus with critical nutrients such as essential amino acids (AA, eg leucine) for development and growth. It also represents a cellular barrier which is formed by a polarized, differentiated syncytiotrophoblast (STB) monolayer. Active Na+ -independent leucine
Sun Young Park et al.
Archives of pharmacal research, 28(4), 421-432 (2005-05-28)
In order to understand the renal reabsorption mechanism of neutral amino acids via amino acid transporters, we have isolated human L-type amino acid transporter 2 (hLAT2) and human T-type amino acid transporter 1 (hTAT1) in human, then, we have examined
Caroline Moret et al.
American journal of physiology. Renal physiology, 292(2), F555-F566 (2006-09-28)
The kidney plays a major role in acid-base homeostasis by adapting the excretion of acid equivalents to dietary intake and metabolism. Urinary acid excretion is mediated by the secretion of protons and titratable acids, particularly ammonia. NH(3) is synthesized in
Ryota Kurayama et al.
Laboratory investigation; a journal of technical methods and pathology, 91(7), 992-1006 (2011-03-16)
Molecular mechanisms and signaling pathways leading to cellular proliferation and lesion formation in the crescentic glomerulonephritis (CGN) remain elusive. In the present study we have explored a potential role of the mammalian target of rapamycin complex 1 (mTORC1) signaling pathway

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service