Skip to Content
Merck
All Photos(2)

Key Documents

WH0386618M4

Sigma-Aldrich

Monoclonal Anti-KCTD4 antibody produced in mouse

clone 2C8, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-bA321C24.3, Anti-potassium channel tetramerisation domain containing 4

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
₹56,765.40

₹56,765.40


Estimated to ship on04 June 2025Details



Select a Size

Change View
100 μG
₹56,765.40

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

₹56,765.40


Estimated to ship on04 June 2025Details


biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2C8, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... KCTD4(386618)

General description

Potassium channel tetramerization domain containing 4 (KCTD4) is suggested to be a subunit of an ion channel and the gene encoding it is localized on human chromosome 13.

Immunogen

KCTD4 (AAH18063, 1 a.a. ~ 259 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIRFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK

Biochem/physiol Actions

Potassium channel tetramerization domain containing 4 (KCTD4) has been shown to be downregulated in chondrosis.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Muhammad Farooq Rai et al.
Arthritis and rheumatism, 65(8), 2090-2101 (2013-05-10)
Meniscus tears are associated with a heightened risk of osteoarthritis. This study aimed to advance our understanding of the metabolic state of injured human meniscus at the time of arthroscopic partial meniscectomy through transcriptome-wide analysis of gene expression in relation
John J Orczyk et al.
The Journal of comparative neurology, 524(1), 152-159 (2015-06-26)
The effects of infraorbital nerve (ION) transection on gene expression in the adult male rat barrel cortex were investigated using RNA sequencing. After a 24-hour survival duration, 98 genes were differentially regulated by ION transection. Differentially expressed genes suggest changes
Brooke L Fridley et al.
BMC medical genomics, 7, 21-21 (2014-04-30)
Genome-wide interrogation of DNA methylation (DNAm) in blood-derived leukocytes has become feasible with the advent of CpG genotyping arrays. In epithelial ovarian cancer (EOC), one report found substantial DNAm differences between cases and controls; however, many of these disease-associated CpGs

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service