Skip to Content
Merck
All Photos(2)

Documents

HPA030978

Sigma-Aldrich

Anti-CREB3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody

Synonym(s):

LZIP, Luman, sLZIP

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL

immunogen sequence

VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CREB3(10488)

General description

CREB3 (CAMP responsive element binding protein 3) is also termed as luman/leucine zipper protein (LZIP). It is a basic leucine zipper transcription factor of the CREB/ATF gene family. It consists of a potent N-terminal acidic activation domain and a basic-leucine zipper motif (bZIP). It is located on human chromosome 9p13.3.

Immunogen

cAMP responsive element binding protein 3

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

CREB3 (CAMP responsive element binding protein 3) induces atherosclerosis through matrix metallopeptidase 9 (MMP-9) transcription and vascular smooth muscle cell migration. Hence, it is considered as a therapeutic target molecule for the treatment of atherosclerosis. CREB3 participates in the modulation of cell growth.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST89296

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Multiple pathways in the FGF signaling network are frequently deregulated by gene amplification in oral dysplasias
Tsui I F L, et al.
International Journal of Cancer. Journal International Du Cancer, 125(9), 2219-2228 (2009)
Luman, the cellular counterpart of herpes simplex virus VP16, is processed by regulated intramembrane proteolysis
Raggo C, et al.
Molecular and Cellular Biology, 22(16), 5639-5649 (2002)
Jeonghan Kim et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 28(11), 5010-5021 (2014-08-01)
Atherosclerosis is a chronic inflammatory response of the vascular wall, and immune responses are involved in every phase of atherosclerosis, from initiation, to progression, and finally to plaque rupture. Cytokines are the major atherogenic mediators that promote plaque formation and

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service