Skip to Content
Merck
All Photos(2)

Key Documents

HPA015497

Sigma-Aldrich

Anti-TMEM115 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-PP6, Anti-Placental protein 6, Anti-Protein PL6, Anti-Transmembrane protein 115

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
₹48,995.40

₹48,995.40


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
₹48,995.40

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

₹48,995.40


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

KTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITF

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TMEM115(11070)

General description

TMEM115 (transmembrane protein 115) is a receptor-like transmembrane Golgi-resident protein, which spans the membrane six to eight times. This gene is localized to human chromosome 3p21.3, spans 4.5kb, and consists of two exons. The encoded 2.2kb mRNA is expressed in multiple normal human tissues such as, breast, lung and kidney. It has a strong and ubiquitous expression pattern in embryo and placenta. This protein is also co-expressed with RAS oncogenic protein family members. It has a pheromone-binding domain, which consists of a rhomboid-like motif. The N- and C-termini face the cytosol, with the C-terminal being composed of ~146 amino acids, and is hydrophobic in nature. The molecular weight of this protein is ~35kDa.

Immunogen

Transmembrane protein 115 recombinant protein epitope signature tag (PrEST)

Application

Anti-TMEM115 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

TMEM115 (transmembrane protein 115) might be involved in signaling pathways. This gene is severely down-regulated in clear cell renal cell carcinomas (CC-RCCs). This expression pattern is dependent on von Hippel-Lindau tumor suppressor gene (VHL)-association of the cancer, rather than hypoxia or HIF1 (hypoxia-inducible factor). It interacts with conserved oligomeric Golgi (COG) complex, and is involved in Golgi-to-ER (endoplasmic reticulum) retrograde transport, which controls Golgi stacks. This protein also plays an essential role in O-linked glycosylation.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73276

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Yan Shan Ong et al.
Journal of cell science, 127(Pt 13), 2825-2839 (2014-05-09)
Searching and evaluating the Human Protein Atlas for transmembrane proteins enabled us to identify an integral membrane protein, TMEM115, that is enriched in the Golgi complex. Biochemical and cell biological analysis suggested that TMEM115 has four candidate transmembrane domains located
A V Ivanova et al.
The Journal of pathology, 214(1), 46-57 (2007-11-02)
Mutations in the von Hippel-Lindau tumour suppressor gene (VHL) cause the VHL hereditary cancer syndrome and occur in most sporadic clear cell renal cell cancers (CC-RCCs). The mechanisms by which VHL loss of function promotes tumour development in the kidney

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service