Skip to Content
Merck
All Photos(4)

Key Documents

HPA009160

Sigma-Aldrich

Anti-NDFIP2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-NEDD4 WW domain-binding protein 5A antibody produced in rabbit, Anti-NEDD4 family-interacting protein 2 antibody produced in rabbit, Anti-Putative MAPK-activating protein PM04/PM05/PM06/PM07 antibody produced in rabbit, Anti-Putative NF-κ-B-activating protein 413 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
₹48,995.40

₹48,995.40


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
₹48,995.40

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

₹48,995.40


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

AAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDN

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NDFIP2(54602)

General description

NDFIP2 (Nedd4 family interacting protein 2) is a small PY element-containing membrane protein. It is a mammalian ortholog of Bsd2, a protein found in Saccharomyces cerevisiae. It is highly identical to NDFIP1. Its N-terminal domain is located at the cytosolic region and contains the PY motifs. It also consists of three transmembrane domains. It is a member of the NEDD (neural precursor cell expressed developmentally down-regulated protein) 4-binding protein family.

Immunogen

NEDD4 family-interacting protein 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

NDFIP2 (Nedd4 family interacting protein 2) functions as a recruiter and activator of multiple NEDD (neural precursor cell expressed developmentally down-regulated protein) 4 proteins in vivo. In vitro it interacts with and activates ITCH protein and various other HECT (homologous to the E6-AP carboxyl terminus) ligases. It also facilitates the ubiquitination of Jun proteins containing a PY motif, as well as that of endophilin, which lacks PY motif. It might suppress the ubiquitylation of PY-containinf proteins, such as connexin-43, by Nedd4, in a competitive manner. This protein has a high level of expression in native renal collecting duct and other tissues expressing ENaC (epithelial sodium channels). Thus, this protein might be implicated in the regulation of ENaC physiological functions. In T-cells, this protein might be responsible for controlling the activity of NEDD4 at the level of Golgi bodies.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71203

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Thomas Mund et al.
EMBO reports, 10(5), 501-507 (2009-04-04)
HECT domain E3 ubiquitin ligases of the NEDD4 family control many cellular processes, but their regulation is poorly understood. They contain multiple WW domains that recognize PY elements. Here, we show that the small PY-containing membrane proteins, NDFIP1 and NDFIP2
Angelos-Aristeidis Konstas et al.
The Journal of biological chemistry, 277(33), 29406-29416 (2002-06-07)
The amiloride-sensitive epithelial sodium channel (ENaC) plays a critical role in fluid and electrolyte homeostasis and consists of alpha, beta, and gamma subunits. The carboxyl terminus of each ENaC subunit contains a PPXY motif that is believed to be important
Anthony D Cristillo et al.
The Journal of biological chemistry, 278(36), 34587-34597 (2003-06-11)
We have cloned and characterized a human cDNA, designated N4WBP5A, that belongs to the family of Nedd4-binding proteins. We originally identified N4WBP5A as an unknown expressed sequence tag (AA770150) represented in a cDNA microarray analysis that was up-regulated upon activation
Chiho Ohzono et al.
Biological & pharmaceutical bulletin, 33(6), 951-957 (2010-06-05)
Nedd4-interacting protein 2 (NDFIP2) has three transmembrane domains and interacts with multiple Nedd4 family ubiquitin ligases through polyprolinetyrosine (PY) motifs located in its N-terminal cytoplasmic domain. It has been postulated that NDFIP2 acts as an adaptor for the ubiquitylation of
Kevin L McKnight et al.
Proceedings of the National Academy of Sciences of the United States of America, 114(25), 6587-6592 (2017-05-12)
The Picornaviridae are a diverse family of RNA viruses including many pathogens of medical and veterinary importance. Classically considered "nonenveloped," recent studies show that some picornaviruses, notably hepatitis A virus (HAV; genus Hepatovirus) and some members of the Enterovirus genus

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service