Skip to Content
Merck
All Photos(1)

Key Documents

AV51203

Sigma-Aldrich

Anti-OLFM4 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-GC1, Anti-GW112, Anti-KIAA4294, Anti-OlfD, Anti-Olfactomedin 4, Anti-bA209J19.1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

55 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... OLFM4(10562)

General description

Olfactomedin-4 (OLFM4), an olfactomedin domain-containing protein, belongs to the olfactomedin-related protein family. OLFM4 is found in the cytoplasm, mitochondria, and membrane including, other subcellular compartments. It is a disulfide-bonded multimer with a signal peptide and six N-linked glycosylation motifs. OLFM4 has a coil-coil domain at the N-terminus and an olfactomedin domain at the C-terminus. Endogenous expression of the OLFM4 protein is seen in mature neutrophils and gastric and intestinal epithelial cells. It is expressed ubiquitously in intestinal crypts and is secreted extracellularly. OLFM4 gene is located on human chromosome 13q14.3.

Immunogen

Synthetic peptide directed towards the C terminal region of human OLFM4

Application

Anti-OLFM4 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Biochem/physiol Actions

Olfactomedin 4 (OLFM4) has a role in tumor growth. OLFM4 has been identified as an anti-apoptotic factor and an extracellular matrix (ECM) glycoprotein.
Olfactomedin-4 (OLFM4) can mediate cell adhesion by binding to cadherins and lectins. It may play a role in the defense of the gastrointestinal mucosal surface. Overexpression of the OLFM4 mRNA is observed in gastric and colon cancer patients. In the human intestine, OLFM4 is considered a powerful marker for stem cells.

Sequence

Synthetic peptide located within the following region: EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Michael Gersemann et al.
Journal of Crohn's & colitis, 6(4), 425-434 (2012-03-09)
Olfactomedin-4 (OLFM4) is a glycoprotein characteristic of intestinal stem cells and apparently involved in mucosal defense of the stomach and colon. Here we studied its expression, regulation and function in IBD. The expression of OLFM4, mucins Muc1 and Muc2, the
Zuyan Luo et al.
Journal of cancer research and clinical oncology, 137(11), 1713-1720 (2011-09-10)
The present study investigated the clinical significance of the relationship between olfactomedin 4 (OLFM4) expression and the clinicopathological features of patients with gastric cancer. Tumor tissue and adjacent normal tissue, lymph nodes, and peritoneal metastases were analyzed by the Affymetrix

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service