Glypican 3 (GPC3), whose gene is associated with Simpson-Golabi-Behmel syndrome, is a heparin sulfate proteoglycan that is anchored to cell-surfaces via glycosylphosphatidylinositol (GPI). Overexpression of glypican 3 occurs in hepatocellular carcinomas (HCC). The silencing of glypican 3 expression leads to apoptosis in HCC.
Specificity
Anti-GPC3 polyclonal antibody reacts with canine, bovine, human, mouse, and rat glypican 3 proteins.
Immunogen
The immunogen for anti-GPC3 antibody: synthetic peptide derected towards the middle region of human GPC3
Application
Anti-GPC3 polyclonal antibody is used to tag glypican 3 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe in cancer diagnosis to detect the presence of glypican 3 in hepatocellular carcinomas (HCC).
Sequence
Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
Physical form
Lyophilized from PBS buffer with 2% sucrose
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
