CLDN17 is a member of the claudin family of proteins. It is a component of tight-junction strands that serve as physical barriers to prevent movement of solutes between the layers of epithelial and endothelial cells. Recently, CLDN17 was shown to have increased expression in breast cancer compared to normal breast tissue.
Immunogen
Synthetic peptide directed towards the middle region of human CLDN17
Biochem/physiol Actions
CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
Sequence
Synthetic peptide located within the following region: KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Pathology oncology research : POR, 18(3), 593-606 (2011-12-24)
In the past few decades an enormous amount of data became known to clarify the molecular composition and architecture of tight junctions (TJs). Despite the efforts, the expression and function of several TJ genes and proteins in breast carcinoma are
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
