Skip to Content
Merck
All Photos(3)

Key Documents

AV32002

Sigma-Aldrich

Anti-ARNTL (AB1) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Aryl hydrocarbon receptor Nuclear translocator-like

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
₹29,181.90

₹29,181.90


Estimated to ship on28 April 2025Details



Select a Size

Change View
100 μL
₹29,181.90

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

₹29,181.90


Estimated to ship on28 April 2025Details


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

25 kDa

species reactivity

sheep, bovine, rat, guinea pig, horse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ARNTL(406)

General description

ARNTL is a basic helix-loop-helix protein that associates with CLOCK to form a heterodimer. ARNTL may be involved in p53-mediated tumor suppression. Furthermore, ARNTL may be linked to bipolar disorder.
Rabbit Anti-ARNTL (AB1) antibody recognizes bovine, pig, canine, human, mouse, and rat ARNTL.

Immunogen

Synthetic peptide directed towards the N terminal region of human ARNTL

Application

Rabbit Anti-ARNTL (AB1) antibody can be used for IHC (4-8μg/ml, using paraffin-embedded tissues) and western blot (5μg/ml) assays.

Biochem/physiol Actions

ARNTL is a general dimerization partner for a subset of the basic-helix-loop-helix (bHLH)-PER-ARNT-SIM (PAS) superfamily of transcriptional regulators.

Sequence

Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jasper Mullenders et al.
PloS one, 4(3), e4798-e4798 (2009-03-12)
The p53 tumor suppressor gene is mutated in about half of human cancers, but the p53 pathway is thought to be functionally inactivated in the vast majority of cancer. Understanding how tumor cells can become insensitive to p53 activation is
Caroline M Nievergelt et al.
American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics, 141B(3), 234-241 (2006-03-11)
Bipolar affective disorder (BPAD) is suspected to arise in part from malfunctions of the circadian system, a system that enables adaptation to a daily and seasonally cycling environment. Genetic variations altering functions of genes involved with the input to the

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service