SAB1404753

Monoclonal Anti-KNTC1, (C-terminal) antibody produced in mouse

clone 10D9, purified immunoglobulin, buffered aqueous solution

• Synonym(s): FLJ36151, KIAA0166, ROD
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 10D9, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~38.21 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_014708
• UniProt accession no.: P50748
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... KNTC1(9735)

Description

General description

This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Experimental evidence indicated that the encoded protein functioned in a similar manner to that of the Drosophila rough deal protein. (provided by RefSeq)

Immunogen

KNTC1 (NP_055523, 2100 a.a. ~ 2209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGILAKTKYFQMLKMHAMNTNNITELVNYLANDLSLDEASVLITEYSKHCGKPVPPDTAPCEILKMFLSGLS

Biochem/physiol Actions

KNTC1 (kinetochore associated 1) is part of the RZZ (Rod–Zw10–Zwilch) complex which is needed for proper kinetochore recruitment. Absence of KNTC1 causes checkpoint failure and early exit from mitosis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable