Skip to Content
Merck
All Photos(4)

Key Documents

HPA023544

Sigma-Aldrich

Anti-DUOX1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Dual oxidase 1, Anti-Large NOX 1, Anti-Long NOX 1, Anti-NADPH thyroid oxidase 1, Anti-Thyroid oxidase 1

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
₪2,929.00

₪2,929.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
₪2,929.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

₪2,929.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:50-1:200

immunogen sequence

QHKEELTWEDFHFMLRDHNSELRFTQLCVKGVEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQP

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DUOX1(53905)

General description

The gene DUOX1 (dual oxidase 1) encodes a protein belonging to the family of NADPH oxidase/heme peroxidase proteins, Duox, and shares upto 85% amino acid similarity with another Duox isoform, Duox2. It contains an NAD(P)H oxidase domain and a heme peroxidase domain. The NAD(P)H oxidase domain of this protein is involved in H2O2 production and the heme peroxidase domain is similar to several peroxidases, but its function is yet to be characterized. The expression of Duox1 is stimulated by Th2 (T helper) cytokines, IL-4 (interleukin-4) and IL-13 (interleukin-13). The gene is mapped to human chromosome 15q15.3.

Immunogen

Dual oxidase 1 Precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

The gene DUOX1 (dual oxidase 1) encodes a dual function NAD(P)H oxidase/peroxidase that serves as an important source for the production of hydrogen peroxide in respiratory tract epithelium. H2O2, thus produced, is involved in the regulation of cellular signaling pathways that participate in the production of inflammatory effectors. ATP-mediated activation of duox1 causes activation of ERK1/2 (extracellular signal-regulated kinase ½) and NFκ-B (nuclear factor κ-light-chain-enhancer of activated B cells) pathways. Duox1 is also involved in the regulation of pathways associated with production of various mucins, matrix metalloproteinase-9, and other inflammatory mediators, in response to environmental or bacterial stimuli.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73296

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

ATP-mediated activation of the NADPH oxidase DUOX1 mediates airway epithelial responses to bacterial stimuli.
Boots AW
The Journal of Biological Chemistry, 284, 17858-17867 (2009)
Effect of iodide on nicotinamide adenine dinucleotide phosphate oxidase activity and Duox2 protein expression in isolated porcine thyroid follicles.
Morand S
Endocrinology, 144, 1241-1248 (2003)
Differential regulation of dual NADPH oxidases/peroxidases, Duox1 and Duox2, by Th1 and Th2 cytokines in respiratory tract epithelium.
Harper RW
Febs Letters, 579, 4911-4917 (2005)
Becky A Diebold et al.
Methods in molecular biology (Clifton, N.J.), 1982, 191-229 (2019-06-07)
The identification of NADPH oxidase (NOX) isoforms in tissues is essential for interpreting experiments and for next step decisions regarding cell lines, animal models, and targeted drug design. Two basic methods, immunoblotting and reverse transcriptase-quantitative polymerase chain reaction (RT-qPCR), are

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service