Skip to Content
Merck
All Photos(5)

Key Documents

HPA023371

Sigma-Aldrich

Anti-DCXR antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Synonym(s):

Anti-Carbonyl reductase II, Anti-Dicarbonyl/L-xylulose reductase, Anti-Kidney dicarbonyl reductase, Anti-L-xylulose reductase, Anti-Sperm surface protein P34H, Anti-XR, Anti-kiDCR

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
₪2,929.00

₪2,929.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
₪2,929.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

₪2,929.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

IRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEG

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DCXR(51181)

General description

Dicarbonyl/L-xylulose reductase, kidney dicarbonyl reductase, sperm surface protein P34H (DCXR, DCR) is an uronate cycle of glucose metabolism NADPH-linked reductase that catalyzes α-dicarbonyl and l-xylulose. DCXR is highly expressed in kidney proximal renal tubule inner membranes. DCXR/P34H is also found on the acrosomal cap of epididymal sperm and is considered to be a marker of sperm maturation.
Rabbit polyclonal DCXR antibody reacts with human dicarbonyl/L-xylulose reductase, kidney dicarbonyl reductase, sperm surface protein P34H.

Immunogen

L-xylulose reductase recombinant protein epitope signature tag (PrEST)

Application

Rabbit polyclonal DCXR antibody is used to tag dicarbonyl/L-xylulose reductase for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of dicarbonyl/L-xylulose reductase in uronate cycle metabolism, and kidney and sperm function.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST75801

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Ann F Hubbs et al.
The American journal of pathology, 181(3), 829-844 (2012-08-17)
Flavorings-related lung disease is a potentially disabling disease of food industry workers associated with exposure to the α-diketone butter flavoring, diacetyl (2,3-butanedione). To investigate the hypothesis that another α-diketone flavoring, 2,3-pentanedione, would cause airway damage, rats that inhaled air, 2,3-pentanedione

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service