Skip to Content
Merck
All Photos(2)

Key Documents

HPA009701

Sigma-Aldrich

Anti-SRCIN1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-AC115090.8 antibody produced in rabbit, Anti-SNAP-25-interacting protein, Anti-SNIP, Anti-p130Cas-associated protein, Anti-p140Cap

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
₪2,929.00

₪2,929.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
₪2,929.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

₪2,929.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

NDLEKSVEKIQRDVSHNHRLVPGPELEEKALVLKQLGETLTELKAHFPGLQSKMRVVLRVEVEAVKFLKEEPQRLDGLLKRCRGVTDTLAQIRR

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SNIP(80725)

General description

SRCIN1 (SRC kinase signaling inhibitor 1) is a docking/adaptor protein, which is commonly known as p140Cap (CAS-associated protein). It is exclusively expressed in epithelial cells, brain and testis. It consists of a tyrosine rich domain, two proline-rich regions, a coil-coiled domain, two charged amino acid-rich domains, and a potential actin binding region. It was initially recognized as a synaptic membrane protein SNAP-25-binding partner.

Immunogen

p130Cas-associated protein recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

SRCIN1 (SRC kinase signaling inhibitor 1) is involved in synapse formation and maintenance in neurons, and in epithelial tumors, controls carcinoma cell characteristics mediated by integrin and growth factor. It interacts with the microtubule plus-end tracking protein EB3. This protein is absent in normal breast tissue, and its mRNA expression acts as a marker for poor prognosis in breast cancer. It is a direct target of miR-374a, and it repeals the oncogenic effects of miR-374a. miR-374a silences SRCIN1 in gastric cancer (GC), which results in elevated cell proliferation, migration and invasion. Its expression is also inhibited by miR-150 in lung cancer, which leads to enhanced cell proliferation and migration. SRCIN1 functions as a downstream effector of endophilin A1 and a disruption in their interaction results in abnormal spine morphogenesis and maturation.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72468

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Minghui Cao et al.
European journal of cancer (Oxford, England : 1990), 50(5), 1013-1024 (2014-01-25)
microRNAs (miRNAs) are a class of endogenously expressed, small non-coding RNAs that play an important role in the regulation of gene expression at the post-transcriptional level. Dysregulation of miRNAs is associated with a variety of diseases, including lung cancer. In
S Kennedy et al.
British journal of cancer, 98(10), 1641-1645 (2008-05-14)
The prevalence and clinical relevance of SNIP/p140Cap has not been extensively investigated. Here SNIP/p140Cap mRNA expression was studied in 103 breast tumour biopsies, where it was detected in approximately 37% of tumour specimens, but not in any normal breast specimens.
Daniele Repetto et al.
PloS one, 8(1), e54931-e54931 (2013-02-06)
Protein phosphorylation tightly regulates specific binding of effector proteins that control many diverse biological functions of cells (e. g. signaling, migration and proliferation). p140Cap is an adaptor protein, specifically expressed in brain, testis and epithelial cells, that undergoes phosphorylation and
Xinyun Xu et al.
FEBS letters, 589(3), 407-413 (2015-01-03)
MicroRNAs (miRNAs) play a prominent role in gastric cancer (GC) initiation and progression. In this study, we found that miR-374a expression was up-regulated in human GC cell lines and tissues. Inhibition of miR-374a suppressed GC cell proliferation, migration and invasion
Yanrui Yang et al.
Cell research, 25(4), 496-516 (2015-03-17)
Dendritic spines are actin-rich membrane protrusions that are the major sites of excitatory synaptic input in the mammalian brain, and their morphological plasticity provides structural basis for learning and memory. Here we report that endophilin A1, with a well-established role

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service