Skip to Content
Merck
All Photos(2)

Key Documents

HPA008519

Sigma-Aldrich

Anti-TAF12 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-TAFII-20/TAFII-15 antibody produced in rabbit, Anti-TAFII20/TAFII15 antibody produced in rabbit, Anti-Transcription initiation factor TFIID 20/15 kDa subunits antibody produced in rabbit, Anti-Transcription initiation factor TFIID subunit 12 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
₪2,929.00

₪2,929.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
₪2,929.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

₪2,929.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

NLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIR

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TAF12(6883)

General description

Transcription initiation factor TFIID subunit 12 (TAF12) is a TBP-associated factor (TAFs). It it a subunit of TFIID and SPT3-TAFII31-GCN5L acetylase (STAGA ) complexes. It contains a histone-fold domain (HFD) which possesses DNA binding capacity.

Immunogen

Transcription initiation factor TFIID subunit 12 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Transcription initiation factor TFIID subunit 12 (TAF12) interacts with cyclic AMP-dependent transcription factor (ATF7), which is modulated by TBP-associated factor 4 (TAF4). It mediates the transcriptional activity of ATF7 where the N-terminal domain of ATF7 and the histone-fold domain (HFD) of TAF12 interact with each other to form a heterodimer. This increases the stability of the complex with the DNA. Along with the complex of TFIID and various other proteins, TAF12 mediates the regulation of RNA polymerase transcription. There is a formation of a nucleosome-like substructure within TFIID which has a tetramer of TAF6 and TAF9 along with homodimers of TAF12.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70900

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Core promoter binding by histone-like TAF complexes.
H Shao
Molecular and Cellular Biology, 25(1), 206-219 (2005)
V V Ogryzko et al.
Cell, 94(1), 35-44 (1998-07-23)
PCAF histone acetylase plays a role in regulation of transcription, cell cycle progression, and differentiation. Here, we show that PCAF is found in a complex consisting of more than 20 distinct polypeptides. Strikingly, some polypeptides are identical to TBP-associated factors
Sebastiaan Werten et al.
The Journal of biological chemistry, 277(47), 45502-45509 (2002-09-19)
The crystal structure is presented of a complex formed by the interacting domains from two subunits of the general transcription factor TFIID, the human TATA binding protein-associated factors hTAF4 (hTAF(II)135) and hTAF12 (hTAF(II)20). In agreement with predictions, hTAF12 forms a
Pierre-Jacques Hamard et al.
Oncogene, 24(21), 3472-3483 (2005-03-01)
The ATF7 proteins, which are members of the cyclic AMP responsive binding protein (CREB)/activating transcription factor (ATF) family of transcription factors, display quite versatile properties: they can interact with the adenovirus E1a oncoprotein, mediating part of its transcriptional activity; they

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service