AV32789

Anti-ACADM antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-Acyl-coenzyme A dehydrogenase, C-4 to C-12 straight chain
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 47 kDa
• species reactivity: human, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001120800
• UniProt accession no.: P11310
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ACADM(34)

Description

General description

ACADM is an acyl CoA dehydrogenase that catalyzes the first step in the β-oxidation of mitochondrial fatty acids. ACADM mutations have been linked to medium-chain acyl-CoA dehydrogenase deficiency (MCADD) in newborns.
Rabbit Anti-ACADM antibody recognizes bovine, human, canine, pig, mouse, and rat ACADM.

Immunogen

Synthetic peptide directed towards the N terminal region of human ACADM

Application

Rabbit Anti-ACADM antibody can be used for western blot applications at a concentration of 5 μg/ml.

Biochem/physiol Actions

ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency.

Sequence

Synthetic peptide located within the following region: ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable