SAB1409675

Monoclonal Anti-BMP7 antibody produced in mouse

clone 1H3, purified immunoglobulin, buffered aqueous solution

• Synonym(s): OP-1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1H3, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 36.41 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG2aκ
• NCBI accession no.: NM_001719
• UniProt accession no.: P18075
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... BMP7(655)

Description

General description

The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development and possible bone inductive activity. (provided by RefSeq)

Immunogen

BMP7 (NP_001710, 293 a.a. ~ 390 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPET

Biochem/physiol Actions

As implied by their name, bone morphogenetic proteins (BMPs) promote and regulate bone development and growth. BMP-7 induces apoptosis in B-cells. It has a role in organ development and may have a role in liver regeneration. Mutations in the gene encoding the protein have been shown to affect the development of teeth, palate and other orofacial complexes.

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable