Skip to Content
Merck
All Photos(1)

Key Documents

SAB1403423

Sigma-Aldrich

Monoclonal Anti-SCGB3A1 antibody produced in mouse

clone 3G5, purified immunoglobulin, buffered aqueous solution

Synonym(s):

HIN-1, HIN1, LU105, MGC87867, PnSP-2, UGRP2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3G5, monoclonal

form

buffered aqueous solution

mol wt

antigen ~37.55 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SCGB3A1(92304)

General description

Secretoglobin family 3A member 1 (SCGB3A1) is a member of secretoglobin gene super family, which contains small secretory proteins. SCGB3A1 is expressed mainly in the epithelial organs, such as the lungs, breast glands, trachea, prostate and salivary glands. SCGB3A1 gene is located on human chromosome 5q35.3.

Immunogen

SCGB3A1 (AAH29176, 1 a.a. ~ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG

Biochem/physiol Actions

Secretoglobin family 3A member 1 (SCGB3A1) plays an important role in cell growth, migration and invasion as a potent inhibitor and these activities are mediated through protein kinase B (PKB/AKT) signal pathway. Aberrant mutations of SCGB3A1 may be used as a prognostic marker for breast cancer and other human malignancies. SCGB3A1 is used as an epigenetic marker for therapy selection in glioblastoma multiforme (GBM). SCGB3A1 plays an important role in inflammation.

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Regulation of mouse Scgb3a1 gene expression by NF-Y and association of CpG methylation with its tissue-specific expression
Tomita T, et al.
BMC Molecular Biology, 9(1), 5-5 (2008)
Aberrant methylation of HIN-1 (high in normal-1) is a frequent event in many human malignancies
Shigematsu H, et al.
International Journal of Cancer. Journal International Du Cancer, 113(4) (2005)
High-resolution genome-wide analysis of chromosomal alterations in elastofibroma
Hernandez J L G , et al.
Virchows Archiv, 456(6) (2010)
Investigation of SCGB3A1 (UGRP2) gene arrays in patients with nasal polyposis
Palal? M , et al.
European Archives of Oto-Rhino-Laryngology : Official Journal of the European Federation of Oto-Rhino-Laryngological Societies (EUFOS) : Affiliated With the German Society for Oto-Rhino-Laryngology - Head and Neck Surgery, 271(12) (2014)
Aberrant promoter methylation of HIN-1 gene may contribute to the pathogenesis of breast cancer: a meta-analysis
Dai D, et al.
Tumour Biology : the Journal of the International Society For Oncodevelopmental Biology and Medicine, 35(8) (2014)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service