MSST0062
SILu™Lite APOD, Apolipoprotein D human
recombinant, expressed in HEK 293 cells, MS Protein Standard, ≥95% (SDS-PAGE)
Synonym(s):
Apo-D, ApoD
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
Recommended Products
General description
SILu™Lite APOD is a recombinant human protein expressed in human 293 cells. It consists of 189 amino acids (including a C-terminal polyhistidine tag), with a calculated molecular mass of 21.69 kDa. SILu™Lite APOD is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Biochem/physiol Actions
Apolipoprotein D is a member of the Apolipoprotein family. Unlike other lipoproteins, which are mainly produced in the liver, apolipoprotein D is mainly produced in the brain and testes. It was found to be a putative biomarker of androgen receptor function in androgen insensitivity syndrome, the most common cause of disorders of sex development. Apolipoprotein D is associated with neurological disorders and nerve injury, especially related to myelin sheath. It was shown to be elevated in a rat model of stroke, and is elevated in patients with schizophrenia, bipolar disorder, and Alzheimer′s disease.
Sequence
QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSDYKDDDDKGHHHHHHHHGGQ
Physical form
Supplied as a lyophilized powder containing phosphate buffered saline.
Legal Information
SILu is a trademark of Sigma-Aldrich Co. LLC
Storage Class Code
11 - Combustible Solids
WGK
WGK 2
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service