Skip to Content
Merck
All Photos(2)

Key Documents

HPA014536

Sigma-Aldrich

Anti-FGD5 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Synonym(s):

Anti-FYVE, RhoGEF and PH domain-containing protein 5, Anti-Zinc finger FYVE domain-containing protein 23

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€507.00

€507.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€507.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

€507.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

NSPQLKSRTGKLRASESPSSLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAMNSDYENIQIPPRRPARAGAFTKLFEDQSRALSTANENDGYVD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FGD5(152273)

General description

Facio-genital dysplasia-5 (FGD5) belongs to Rho GTP-GDP exchange factors family. This protein is composed of a Dbl homology (DH) domain, a PH (Pleckstrin homology) domain, a FYVE-finger domain and a second PH domain located at the C-terminal. It is exclusively expressed in both mature and progenitor endothelial cells (ECs). It resides in early endosomes and membrane ruffles.

Immunogen

FYVE, RhoGEF and PH domain-containing protein 5 recombinant protein epitope signature tag (PrEST)

Application

Anti-FGD5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

The function of Facio-genital dysplasia-5 (FGD5) is yet unknown. It causes vaso-obliteration through apoptosis by activating hey1-p53 pathway. Through this mechanism, it prevents neo-vascularization. It also binds to and activates cdc42. It is therefore, involved in vascular pruning during vascular remodeling through apoptosis of endothelial cells (ECs). It regulates phosphatidylinositol 3-kinase signaling, and thereby controls the survival and adhesion of endothelial cells. As FGD5 is localized to membrane ruffles, it might control EC structure, adhesion and migration via controlling the reorganization of actin cytoskeleton. It is also found in early endosome, and thus, might play a role in membrane transport through the activation of cdc42. It might also be involved in the activation of ERK (extracellular signal-regulated kinases) and thus, play a role in membrane ruffling.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72675

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Maryam Nakhaei-Nejad et al.
Arteriosclerosis, thrombosis, and vascular biology, 32(11), 2694-2701 (2012-08-28)
The function of the endothelial cell (EC)-enriched Rho family guanine nucleotide exchange factor, facio-genital dysplasia-5 (FGD5), is poorly understood. We sought to determine whether FGD5 regulates endothelial cytoskeletal reorganization and angiogenesis. We observed that FGD5 is expressed in primary human
Yusuke Kurogane et al.
Arteriosclerosis, thrombosis, and vascular biology, 32(4), 988-996 (2012-02-14)
Vascular endothelial growth factor (VEGF) exerts proangiogenic action and induces activation of a variety of proangiogenic signaling pathways, including the Rho family small G proteins. However, regulators of the Rho family small G proteins in vascular endothelial cells (ECs) are
Caroline Cheng et al.
Circulation, 125(25), 3142-3158 (2012-06-05)
New vessel formation contributes to organ development during embryogenesis and tissue repair in response to mechanical damage, inflammation, and ischemia in adult organisms. Early angiogenesis includes formation of an excessive primitive network that needs to be reorganized into a secondary

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service