Skip to Content
Merck
All Photos(1)

Key Documents

AV34957

Sigma-Aldrich

Anti-CACNB3 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Calcium channel, voltage-dependent, β 3 subunit

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€297.00

€297.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€297.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€297.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

53 kDa

species reactivity

horse, human, guinea pig, rat, mouse, bovine, rabbit, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CACNB3(784)

General description

Voltage-dependent L-type calcium channel subunit β-3 (CACNB3) is the β subunit critical for proper functioning of the voltage-dependent L-type calcium channel by increasing calcium current. It is a 54 kDa protein shown to be critical for renal and cardiac cell functioning as well as the survival of CD8+ T lymphocytes.

Immunogen

Synthetic peptide directed towards the C terminal region of human CACNB3

Biochem/physiol Actions

The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

Sequence

Synthetic peptide located within the following region: EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Henry M Colecraft et al.
The Journal of physiology, 541(Pt 2), 435-452 (2002-06-04)
Recombinant adenoviruses were used to overexpress green fluorescent protein (GFP)-fused auxiliary Ca(2+) channel beta subunits (beta(1)-beta(4)) in cultured adult rat heart cells, to explore new dimensions of beta subunit functions in vivo. Distinct beta-GFP subunits distributed differentially between the surface
Mithilesh K Jha et al.
Nature immunology, 10(12), 1275-1282 (2009-10-20)
The survival of T lymphocytes requires sustained, Ca(2+) influx-dependent gene expression. The molecular mechanism that governs sustained Ca(2+) influx in naive T lymphocytes is unknown. Here we report an essential role for the beta3 regulatory subunit of voltage-gated calcium (Ca(v))

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service