Skip to Content
Merck
All Photos(2)

Key Documents

AV31957

Sigma-Aldrich

Anti-HOXC4 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Homeobox C4

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€337.00

€337.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€337.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€337.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

29 kDa

species reactivity

rabbit, bovine, dog, human, guinea pig, horse, mouse, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HOXC4(3221)

General description

HOXC4 is a homeobox transcription factor that is involved in the differentiation of lymphoid cells and keratinocytes.
Rabbit Anti-HOXC4 recognizes human, mouse, rat, canine, zebrafish, and bovine HOXC4.

Immunogen

Synthetic peptide directed towards the N terminal region of human HOXC4

Application

Rabbit Anti-HOXC4 can be used for western blot applications at a concentration of 2μg/ml.

Biochem/physiol Actions

HOXC4 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, are co-transcribed in a primary transcript. Subsequent processing results in gene-specific transcripts, which sometimes share a 5′ non-coding exon.

Sequence

Synthetic peptide located within the following region: MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

E Rieger et al.
The Journal of investigative dermatology, 103(3), 341-346 (1994-09-01)
Homeobox (HOX) genes share a highly conserved 183-bp sequence. The encoded proteins are capable of binding to specific DNA sequences and functioning as transcription factors. HOX genes play a critical role in the temporal and spatial differentiation of cells during
J Bijl et al.
Blood, 87(5), 1737-1745 (1996-03-01)
Besides their regulatory role in embryogenesis, homeobox (HOX) genes are expressed in a specific manner in hematopoietic cell lineages, implying a role in the molecular regulation of hematopoiesis. Some HOX C cluster genes are found to be expressed in lymphoid

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service