Skip to Content
Merck
All Photos(2)

Key Documents

AV100960

Sigma-Aldrich

Anti-PC4 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
€297.00

€297.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
€297.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

€297.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

14 kDa

species reactivity

rat, bovine, dog, mouse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PC4(10923)

Immunogen

Synthetic peptide directed towards the middle region of human PC4

Application

Anti-PC4 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5-1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.

Biochem/physiol Actions

PC4 is a chromatin associated protein that contains a non-specific DNA-binding domain. It is involved in processes of replication, transcription and DNA repair. It exhibits a complex role with negative and positive effects on gene expression by influencing transcription initiation, elongation, termination and reinitiation processes. It stimulates ligase-mediated DNA end joining and activates double-strand break (DSB) repair activity. PC4 is a positive activator of p53 and is overexpressed during genotoxic insult to the cells.

Sequence

Synthetic peptide located within the following region: NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Kiran Batta et al.
Journal of molecular biology, 385(3), 788-799 (2008-11-29)
Human transcriptional coactivator PC4 is a highly abundant nuclear protein that is involved in diverse cellular processes ranging from transcription to chromatin organization. Earlier, we have shown that PC4, a positive activator of p53, overexpresses upon genotoxic insult in a
Christine Conesa et al.
RNA biology, 7(3), 287-290 (2010-03-23)
Yeast Sub1 and its human ortholog PC4 display multiple cellular functions in vivo. Sub1/PC4 contains a unique conserved non-specific DNA-binding domain and is involved in distinct DNA-dependent processes including replication, DNA repair and transcription. Sub1/PC4 is a non-histone chromatin-associated protein

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service