Skip to Content
Merck
All Photos(1)

Key Documents

SAB2100988

Sigma-Aldrich

Anti-GTF2E2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-FE, Anti-General transcription factor IIE, polypeptide 2, β 34kDa, Anti-TF2E2, Anti-TFIIE-B

Sign Into View Organizational & Contract Pricing
All Photos(1)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

33 kDa

species reactivity

rabbit, goat, rat, mouse, dog, guinea pig, horse, bovine, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

UniProt accession no.

P29084

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... GTF2E2(2961)

Immunogen

Synthetic peptide directed towards the middle region of human GTF2E2

Biochem/physiol Actions

GTF2E2 belongs to the TFIIE beta subunit family.It recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase.

Sequence

Synthetic peptide located within the following region: ISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Christiane Kuschal et al.
American journal of human genetics, 98(4), 627-642 (2016-03-22)
The general transcription factor IIE (TFIIE) is essential for transcription initiation by RNA polymerase II (RNA pol II) via direct interaction with the basal transcription/DNA repair factor IIH (TFIIH). TFIIH harbors mutations in two rare genetic disorders, the cancer-prone xeroderma
Aki Tanaka et al.
Genes to cells : devoted to molecular & cellular mechanisms, 14(3), 395-405 (2009-02-13)
The human general transcription factor, TFIIE, consists of two subunits, alpha and beta. Structural analyses indicated the presence of a forkhead motif within the central region of TFIIEbeta. This motif was essential for transcription and possessed a double-stranded DNA-binding activity.
Tomomichi Watanabe et al.
Molecular and cellular biology, 23(8), 2914-2926 (2003-04-01)
The general transcription factor TFIIE plays essential roles in both transcription initiation and the transition from initiation to elongation. Previously, we systematically deleted the structural motifs and characteristic sequences of the small subunit of human TFIIE (hTFIIE beta) to map
Angelica Ronald et al.
Behavior genetics, 40(1), 31-45 (2009-12-17)
Two separate genome-wide association studies were conducted to identify single nucleotide polymorphisms (SNPs) associated with social and nonsocial autistic-like traits. We predicted that we would find SNPs associated with social and non-social autistic-like traits and that different SNPs would be

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service