Skip to Content
Merck
All Photos(1)

Key Documents

AV34600

Sigma-Aldrich

Anti-CBX8 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Chromobox homolog 8 (Pc class homolog, Drosophila)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

43 kDa

species reactivity

human, guinea pig, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CBX8(57332)

General description

CBX8 is a polycomb group protein that associates with other proteins such as TIP60 and MLL-AF9. CBX8 also forms a part of the PRC1 complexes. It regulates fibroblast proliferation and cell survival. Furthermore, studies have reported that CBX8 is needed for MLL-AF9-induced transcription and leukemogenesis.
Rabbit Anti-CBX8 (AB1) antibody recognizes bovine, human, mouse, rat, and canine CBX8.

Immunogen

Synthetic peptide directed towards the middle region of human CBX8

Application

Rabbit Anti-CBX8 (AB1) antibody can be used for western blot applications at a concentration of 0.25 μg/ml.

Biochem/physiol Actions

CBX8 is one of the proteins homolog to the Polycomb group (PcG) proteins. They assemble to form large multiprotein complexes involved in gene silencing. Evidence suggests that PcG complexes are heterogeneous with respect to both protein composition and specific function.

Sequence

Synthetic peptide located within the following region: QCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGALDPNGTRVRH

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jiaying Tan et al.
Cancer cell, 20(5), 563-575 (2011-11-19)
Chromosomal translocations involving the mixed lineage leukemia (MLL) gene lead to the development of acute leukemias. Constitutive HOX gene activation by MLL fusion proteins is required for MLL-mediated leukemogenesis; however, the underlying mechanisms remain elusive. Here, we show that chromobox
Nikolaj Dietrich et al.
The EMBO journal, 26(6), 1637-1648 (2007-03-03)
The Polycomb group (PcG) proteins are essential for embryogenesis, and their expression is often found deregulated in human cancer. The PcGs form two major protein complexes, called polycomb repressive complexes 1 and 2 (PRC1 and PRC2) whose function is to

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service