SAB1409724

Monoclonal Anti-TBX6 antibody produced in mouse

clone 3F11, purified immunoglobulin, buffered aqueous solution

• Szinonimák: DFNB67
• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 3F11, monoclonal
• Forma: buffered aqueous solution
• molekulatömeg: antigen 36.63 kDa
• faj reaktivitás: human
• technika/technikák: indirect ELISA: suitable; western blot: 1-5 μg/mL

Leírás

Általános leírás

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Knockout studies in mice indicate that this gene is important for specification of paraxial mesoderm structures. (provided by RefSeq)

Immunogén

TBX6 (NP_004599, 102 a.a. ~ 200 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KEFSSVGTEMIITKAGRRMFPACRVSVTGLDPEARYLFLLDVIPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPATGAHWMRQPVSFHRVKLTNS*

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 3
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable