Skip to Content
Merck
All Photos(3)

Key Documents

View All Documentation

I17001

Sigma-Aldrich

Interferon-γ human

IFN-gamma, recombinant, expressed in HEK 293 cells, suitable for cell culture, endotoxin tested

Synonym(s):

IFN-γ

Sign Into View Organizational & Contract Pricing
All Photos(3)

About This Item

MDL number:
MFCD00131391
UNSPSC Code:
12352202
NACRES:
NA.77
Pricing and availability is not currently available.

recombinant

expressed in HEK 293 cells

Quality Level

200

Assay

≥98% (SDS-PAGE)

form

lyophilized powder

potency

≤0.250 ng/mL In Viral Resistance Assay ED50

mol wt

16 kDa (glycosylated)

technique(s)

cell culture | mammalian: suitable

suitability

endotoxin tested

storage temp.

−20°C

Looking for similar products? Visit Product Comparison Guide

General description

Interferon-γ (IFN-γ) is a pleotropic cytokine, encoded by the gene mapped to human chromosome 12q15.[1] It is a non-covalent homodimer with two identical 17kDa polypeptide chains. It belongs to the type II class of interferons.[2][1]
Recombinant human Interferon-γ (IFN-γ) is expressed in human 293 cells as a glycoprotein with a calculated molecular mass of 16 kDa. This protein is manufactured in human cells using an all-human production system, with full chemically defined ingredients and with no serum. The human cells expression system allows human-like glycosylation and folding, and often supports better stability of the protein in culture. The bioactivity of IFN-γ expressed in human 293 cells is significantly higher compared to bacterially expressed IFN-γ.

Application

Interferon-γ human has been used in cytometric bead array to measure the levels of interferon-γ in the sample.[3]
It has also been used for cytokine treatment of human islets to evaluate the activation of hypoxia inducible factor 1 α (HIF1α) targets, in vitro.[4]

Biochem/physiol Actions

IFN-γ is a dimerized soluble cytokine that is the only member of the type II class of interferons.
Interferon-γ (IFN-γ) plays an essential role in function of virtually all immune cells and both innate and adaptive immune responses.[5] IFN-γ exhibits various biological effects, such as antiviral activity, inhibition of cell or tumor growth and promotion of terminal differentiation of B cells into immunoglobulin-producing cells.[6] This cytokine also activates macrophages, increases cytotoxicity of natural killer cells and promotes T cell cytotoxicity.[6] In addition to antiviral activity, recombinant human IFN-γ is a potent modulator of immune responses and modifies cellular processes.

Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Analysis Note

The biological activity of recombinant human IFN-γ was tested in culture in a viral resistance assay. The ED50 is defined as the effective concentration of IFN-γ that allows 50% cell growth in an antiviral cell based bioassay.

Storage Class Code

11 - Combustible Solids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
0000245849
0000210321
0000179736
029M4821V
057M4870V

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The IFNγ receptor: a paradigm for cytokine receptor signaling.
Bach E A, et al.
Annual Review of Immunology, 15(1), 563-591 (1997)
Class II cytokine receptors and their ligands: key antiviral and inflammatory modulators.
Renauld J C.
Nature Reviews: Immunology, 3(8), 667-667 (2003)
Livia S A Passos et al.
Frontiers in cardiovascular medicine, 8, 804111-804111 (2022-02-08)
Mitral regurgitation (MR) is a major complication of the percutaneous mitral valvuloplasty (PMV). Despite high technical expertise and cumulative experience with the procedure, the incidence rate of severe MR has not decreased. Although some of MR can be anticipated by
Expression and reconstitution of a biologically active mouse interferon gamma receptor in hamster cells. Chromosomal location of an accessory factor.
Hibino Y, et al.
The Journal of Biological Chemistry, 266(11), 6948-6951 (1991)
Clinical use of interferon?γ.
Miller C H, et al.
Annals of the New York Academy of Sciences, 1182(1), 69-79 (2009)
View All Related Papers

Questions

1–2 of 2 Questions  

  1. How many Units are contained in 1 ug of this product?

    1 answer

    1. This product is supplied as a 100 uG pack size. The unit activity is reported on the lot specific Certificate of Analysis. See the link below to review a sample Certificate of Analysis: https://www.sigmaaldrich.com/certificates/sapfs/PROD/sap/certificate_pdfs/COFA/Q14/I17001-100UG-PW0000210321.pdf

      For this specific lot, the reported activity is 76,000,000 units per milligram (1000 uG). The unit per microgram value for this lot is 76,000.

      Helpful?

  2. How the product I17001 can be reconstituted?

    1 answer

    1. Briefly centrifuge the vial before opening. It is recommended to reconstitute
      the protein in sterile, double-distilled water to a final concentration of 100 µg/ml.

      Please refer to this link for additional information about the product: https://www.sigmaaldrich.com/deepweb/assets/sigmaaldrich/product/documents/579/551/i17001dat.pdf

      Helpful?

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service