WH0007442M1

Monoclonal Anti-TRPV1 antibody produced in mouse

clone 1F5, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Trpv1 Antibody, Trpv1 Antibody - Monoclonal Anti-TRPV1 antibody produced in mouse, Anti-DKFZp434K0220, Anti-VR1, Anti-transient receptor potential cation channel, subfamily V, member 1
• MDL number: MFCD02686673
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1F5, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: NM_080706
• UniProt accession no.: Q8NER1
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TRPV1(7442)

Descripción

General description

The gene encoding transient receptor potential cation channel subfamily V member 1 (TRPV1) is mapped to human chromosome 17p13. It is a non-selective cation channel. The protein is expressed on airway nerve fibers. It is also strongly expressed in sensory neurons.

Immunogen

TRPV1 (NP_542437, 21 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ

Biochem/physiol Actions

Transient receptor potential cation channel subfamily V member 1 (TRPV1) is a capsaicin receptor. It participates in pain perception. TRPV1 also modulates afferent signals and bronchoconstriction. In the brain, it regulates neuronal function, motor behaviour and neuroinflammation. Capsaicin plays an important role in the activation of TRPV1.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)