SAB1406373

Anti-RARRES2 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Sinónimos: CHEMERIN, HP10433, TIG2
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen ~18.6 kDa
• species reactivity: human
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: NM_002889.2
• UniProt accession no.: Q99969
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RARRES2(5919)

Descripción

General description

This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine, and is truncated on both termini from the proprotein. (provided by RefSeq)

Immunogen

RARRES2 (NP_002880.1, 1 a.a. ~ 163 a.a) full-length human protein.

Sequence
MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS

Biochem/physiol Actions

Chemerin activates chemerin-like receptor 1 (CMKLR1) and stimulates chemotaxis in macrophages, natural killer cells and immature dendritic cells. It is also involved in the activation of extracellular signal-regulated kinases, stimulation of blood vessel formation, migration and invasion.

Physical form

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable