HPA019849

Anti-RAB27B antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-C25KG, Anti-Ras-related protein Rab-27B
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA019849
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• enhanced validation: orthogonal RNAseq; recombinant expression; Learn more about Antibody Enhanced Validation
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:1000-1:2500
• immunogen sequence: FETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
• UniProt accession no.: O00194
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RAB27B(5874)

Descripción

General description

RAB27B (member RAS oncogene family) is a membrane-bound, prenylated, rab proteins belonging to a melanocyte/platelet subfamily within the rab family. It is mainly expressed in the testis, also in heart, brain, spleen and kidney. It is mapped on chromosome 18q21.1 region.

Immunogen

Ras-related protein Rab-27B recombinant protein epitope signature tag (PrEST)

Application

Anti-RAB27B antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

RAB27B (member RAS oncogene family) is mainly associated with two vital processes such as vesicular fusion and trafficking. It acts as a GTP-binding factor. Chromosomal mapping study has been reported its association with Griscelli Disease, which is characterized with partial albinism and severe immunodeficiency.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73807

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable