HPA011332

Anti-IGF2R antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-300 kDa mannose 6-phosphate, Anti-CI Man-6-P receptor, Anti-CI-MPR, Anti-Cation-independent mannose-6-phosphate receptor precursor, Anti-IGF-II receptor, Anti-Insulin-like growth factor 2 receptor, Anti-Insulin-like growth factor II receptor, Anti-M6P/IGF2 receptor, Anti-M6P/IGF2R, Anti-M6PR
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA011332
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• immunogen sequence: CKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGHQAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSE
• UniProt accession no.: P11717
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... IGF2R(3482)

Descripción

General description

IGF2R (insulin-like growth factor 2 receptor) is a transmembrane glycoprotein. It is one of the two mannose 6-phosphate (M6P) receptors found in mammalian cells. It has 15 consecutive repeating regions making up a repetitive structure. The domains 3 and 9 contain M6P-binding sites. Domain 5 contains M6P-N-acetylglucosamine residue- binding site. The IGF-II binding site is located in domain 11. It belongs to p-lectin family and has a molecular weight of 300kDa. It has an N-terminal, a small cytosolic C-terminal, a transmembrane region and a large exosolic domain.

Immunogen

Cation-independent mannose-6-phosphate receptor precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-IGF2R antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

IGF2R (insulin-like growth factor 2 receptor) regulates multiple cellular processes such as, cell survival, proliferation, migration and invasion, endocytosis, lysosomal trafficking. Its ligands are divided in two major classes- mannose 6-phosphate (M6P)-containing and non-M6P. The former class includes lysosomal acid hydrolases, TGF (transforming growth factor)-β, proliferin, thyroglobulin, and granzyme B, while the latter class includes mitogen, plasminogen, insulin-like growth factor II (IGF-II) and retinoic acid. Binding of plasminogen to IGF2R leads to the conversion and activation of plasminogen to plasmin. This gene is also mutated in multiple cancers where it might lead to tumorigenesis. It is down-regulated in breast cancer where it supposedly facilitates tumorigenesis. It decreases the metastatic capacity of receptor-deficient SCC-VII squamous cell carcinoma cells, which in turn is modulated by M6P-binding site within domain 3.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86865

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)