Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV34537

Sigma-Aldrich

Anti-KLHL25 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Kelch-like 25 (Drosophila)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

66 kDa

reactividad de especies

human, dog, mouse, rat, guinea pig

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... KLHL25(64410)

Descripción general

KLHL25 is a kelch-like family member that complexes with CUL3 to form E3 ubiquitin ligase complex. This complex is known to target hypophosphorylated 4E-BP1.
Rabbit Anti-KLHL25 antibody recognizes canine, human, mouse, and rat KLHL25.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human KLHL25

Aplicación

Rabbit Anti-KLHL25 antibody is suitable for western blot applications at a concentration of 2 μg/ml.

Acciones bioquímicas o fisiológicas

KLHL25 is also known as ENC2. It is a BTB/POZ KELCH domain protein

Secuencia

Synthetic peptide located within the following region: SRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENA

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Akiko Yanagiya et al.
Molecular cell, 46(6), 847-858 (2012-05-15)
Translational control of gene expression plays a key role in many biological processes. Consequently, the activity of the translation apparatus is under tight homeostatic control. eIF4E, the mRNA 5' cap-binding protein, facilitates cap-dependent translation and is a major target for

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico