Skip to Content
Merck
All Photos(4)

Key Documents

SAB2108752

Sigma-Aldrich

Anti-WT1

affinity isolated antibody

Synonym(s):

Anti- AWT1, Anti- WAGR, Anti- WIT-2, Anti- WT33, Anti-GUD

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

56 kDa

species reactivity

human, rabbit, dog, rat, mouse

concentration

0.5-1 mg/mL

technique(s)

immunoblotting: suitable
immunohistochemistry: suitable

accession no.

NM_024424

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... WT1(7490)

General description

Wilms tumor 1 (WT1) gene is located on 11p13 in the human chromosome.

Immunogen

Synthetic peptide directed towards the middle region of human WT1

Biochem/physiol Actions

WT1 is a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system. WT1 has both oncogenic and tumor suppressor properties, and also acts as a transcription factor at the early organ developmental stage. WT1 regulates the mesenchyme and modulates the development of mesodermal organs. WT1 is known to cause kidney cancer or nephroblastoma in children. Mutations in WT1 causes diseases of urogenital system like Denys-Drash syndrome, Frasier syndrome. WT1 is being associated with haematological malignancies and solid tumours.

Sequence

Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Structure of the Wilms tumor suppressor protein zinc finger domain bound to DNA
Stoll R, et al.
Journal of Molecular Biology, 372(5), 1227-1245 (2007)
Donor splice-site mutations in WT1 are responsible for Frasier syndrome
Barbaux S, et al.
Nature Genetics, 17(4), 467-467 (1997)
Wilms? tumor 1 (WT1) protein expression in human developing tissues
Parenti R, et al.
Acta Histochemica, 117(4-5), 386-396 (2015)
The tumor suppressor WTX shuttles to the nucleus and modulates WT1 activity
Rivera et al.
Proceedings of the National Academy of Sciences of the USA, 106(20), 8338-8343 (2009)
New insights into DNA-binding behaviour of Wilms Tumor Protein (WT1)?A dual study
Nurmemmedov E, et al.
Biophysical Chemistry, 145(2-3), 116-125 (2009)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service