HPA015284
Anti-HLTF antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-DNA-binding protein/plasminogen activator inhibitor 1 regulator, Anti-HIP, Anti-Helicase-like transcription factor, Anti-SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3, Anti-Sucrose nonfermenting protein 2-like 3
Sign Into View Organizational & Contract Pricing
All Photos(6)
About This Item
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, mouse, rat
enhanced validation
orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
immunogen sequence
LKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGK
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... HLTF(6596)
General description
HLTF (helicase-like transcription factor) is a seven DNA helicase domain containing member of the SWI/SNF (mating-type switching/sucrose non-fermenting) family. Studies in HeLa cells show six isoforms of this protein, with the full length protein having a molecular weight of 115kDa. The 95kDa form lacks the helicase domains, present at the C-terminal, which are involved in DNA repair. It is a human ortholog of yeast Rad5 protein. This protein contains a Rad5-like domain, and a SWI/SNF helicase domain. This domain contains a C2HC4 RING domain.
Immunogen
Helicase-like transcription factor recombinant protein epitope signature tag (PrEST)
Application
Anti-HLTF antibody is suitable for chromatin immunoprecipitation (ChIP). Anti-HLTF antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
HLTF (helicase-like transcription factor) interacts and binds with DNA to control transcription. It utilizes the energy of ATP hydrolysis for chromatin remodeling, which is basic to multiple cellular processes. It plays a role in post-replication DNA repair, where it functions as E3 ubiquitin ligase and uniquitinates proliferating cell nuclear antigen (PCNA). This protein, along with translesion synthesis polymerases, is recruited to chromatin by the tumor suppressor protein BRCA1 (breast cancer 1, early onset). In stalled damaged DNA replication, this protein repairs the gaps in the replication fork. HLTF is hypermethylated and inactivated in multiple cancers such as, esophageal, gastric, colorectal and uterine cancer. Its expression correlates with the progression of thyroid neoplasia. Thus, it has potential as a marker to differentiate benign from malignant thyroid tumors. In cervical cancer, it increases the DNA repair capacity, and thus, confers resistance to radiotherapy.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST73675
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Peter Burkovics et al.
Nucleic acids research, 42(3), 1711-1720 (2013-11-08)
Stalling of replication forks at unrepaired DNA lesions can result in discontinuities opposite the damage in the newly synthesized DNA strand. Translesion synthesis or facilitating the copy from the newly synthesized strand of the sister duplex by template switching can
Vanessa Arcolia et al.
BMC cancer, 14, 492-492 (2014-07-10)
The preoperative characterization of thyroid nodules is a challenge for the clinicians. Fine-needle aspiration (FNA) is the commonly used pre-operative technique for diagnosis of malignant thyroid tumor. However, many benign lesions, with indeterminate diagnosis following FNA, are referred to surgery.
SungHwan Cho et al.
Journal of cancer research and clinical oncology, 137(4), 629-637 (2010-06-11)
Helicase-like transcription factor (HLTF) is a member of the SWI/SNF (mating type switching/sucrose non-fermenting) family of ATPases/helicases and also has a RING-finger motif characteristic of ubiquitin ligase proteins. These features have led to suggestions that HLTF functions like yeast Rad5
Rebecca A Helmer et al.
PloS one, 16(5), e0251132-e0251132 (2021-05-20)
Methylation of the HLTF gene in colorectal cancer (CRC) cells occurs more frequently in men than women. Progressive epigenetic silencing of HLTF in tumor cells is accompanied by negligible expression in the tumor microenvironment (TME). Cell line-derived xenografts (CDX) were
Rebecca A Helmer et al.
PloS one, 8(6), e66799-e66799 (2013-07-05)
HLTF participates in transcription, chromatin remodeling, DNA damage repair, and tumor suppression. Aside from being expressed in mouse brain during embryonic and postnatal development, little is known about Hltf's functional importance. Splice variant quantification of wild-type neonatal (6-8 hour postpartum)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service