Skip to Content
Merck
All Photos(3)

Documents

WH0006623M1

Sigma-Aldrich

Monoclonal Anti-SNCG antibody produced in mouse

clone 2C3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-BCSG1, Anti-SR, Anti-synuclein, gamma (breast cancer-specific protein 1)

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2C3, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SNCG(6623)

General description

Synuclein gamma (SNCG) gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. (provided by RefSeq).
Synuclein gamma (SNCG) is a breast cancer specific gene. SNCG is highly expressed in malignant cancer cells and neuronal cells. SNCG gene is located on human chromosome 10q23.2. SNCG is a member of the brain protein synuclein family.

Immunogen

SNCG (AAH14098, 21 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

Application

Monoclonal Anti-SNCG antibody produced in mouse has been used in western blotting.

Biochem/physiol Actions

Synuclein gamma (SNCG) induces migration, invasion and metastasis of tumor cells. It promotes the migration of human breast adenocarcinoma cell line (MCF7) by activating extracellular-signal regulated kinase (Erk) pathway and disrupting cell-cell junctions. SNCG is associated with breast or ovarian cancer progression. Urine SNCG is used as a prognostic biomarker for bladder cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Synuclein-γ promotes migration of MCF7 breast cancer cells by activating extracellular-signal regulated kinase pathway and breaking cell-cell junctions
Zhuang Q, et al.
Molecular Medicine Reports, 12(3) (2015)
Synuclein γ compromises spindle assembly checkpoint and renders resistance to antimicrotubule drugs
Miao S, et al.
Molecular Cancer Therapeutics (2014)
The future of genetic association studies in Alzheimer disease
Finckh U, et al.
Journal of neural transmission (Vienna, Austria : 1996), 110(3), 253-266 (2003)
γ synuclein, a novel heat-shock protein-associated chaperone, stimulates ligand-dependent estrogen receptor $\alpha$ signaling and mammary tumorigenesis
Jiang Y, et al.
Cancer Research, 64(13) (2004)
Urine gamma-synuclein as a biomarker for the diagnosis of bladder cancer
Liu C, et al.
Oncotarget, 7(28), 43432-43432 (2016)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service