Skip to Content
Merck
All Photos(7)

Key Documents

WH0003843M1

Sigma-Aldrich

Monoclonal Anti-RANBP5 antibody produced in mouse

clone 1C4, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-IMB3, Anti-IPO5, Anti-KPNB3, Anti-MGC2068, Anti-RAN binding protein 5

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1C4, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IPO5(3843)

General description

IPO5 (importin 5) is a member of the importin β superfamily of transport receptors. It is a Ran-binding protein which is also termed as RanBP5, importin β3 and karyopherin β3 (KPNB3). IPO5 is mostly present in the cytoplasm. This gene is located on human chromosome 13q32.
Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. Interactions between importin beta and the FG repeats of nucleoporins are essential in translocation through the pore complex. The protein encoded by this gene is a member of the importin beta family. (provided by RefSeq)

Immunogen

RANBP5 (AAH01497, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFDEVYPALPSDVQTAIKSELLMIIQME

Biochem/physiol Actions

IPO5 (importin 5) is required for the life cycle of influenza A virus and human papillomavirus-16 as it transports specific viral proteins into the nucleus. It act as the trans -acting factor to promote the nuclear translocation of CPEB3 (cytoplasmic polyadenylation element-binding protein) in NMDA-treated (N -methyl-D-aspartate) neurons. Overexpression and alternative splicing of the IPO5 gene is expected to participate in the pathophysiology of schizophrenia.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Novel mutation and three other sequence variants segregating with phenotype at keratoconus 13q32 susceptibility locus
Czugala M, et al.
European Journal of Human Genetics, 20(4), 389-397 (2012)
NMDAR signaling facilitates the IPO5-mediated nuclear import of CPEB3
Chao HW, et al.
Nucleic Acids Research, 40(17), 8484-8498 (2012)
Zhen-Qi Wang et al.
Psychiatry research, 187(3), 460-461 (2010-06-15)
The present work reported on a weak association of the importin 5 (IPO5) gene with schizophrenia in combined family and case-control samples and also investigated a possible mechanism by which the IPO5 gene may contribute to the development of the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service