Skip to Content
Merck
All Photos(5)

Key Documents

HPA031149

Sigma-Aldrich

Anti-CD200 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CD200 molecule, Anti-MOX1, Anti-MOX2, Anti-MRC, Anti-OX-2, Anti-ST1C1, Anti-SULT1C1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

EREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... CD200(4345)

General description

CD200 (CD_antigen 200) gene is mapped to human chromosome 3q13.2. The gene encodes a transmembrane glycoprotein that belongs to the immunoglobulin superfamily. CD200 is widely expressed in different tissues and cell types such as lymphocytes, kidney glomeruli, neurons and endothelial cells. Its receptor is mainly expressed by myeloid cells (granulocytes, monocytes and macrophages).

Immunogen

CD200 molecule recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-CD200 antibody produced in rabbit has been used in immunofluorescence.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

Biochem/physiol Actions

CD200 (CD_antigen 200) has an immunosuppressive effect on cells expressing its receptor, CD200R. CD200 is involved in maintaining immune homeostasis. CD200 reduces the immune system′s reaction to vaccines, while inhibition of CD200 expression can enhance the efficacy of cancer immunotherapy. The gene is known to be overexpressed in a number of human cancers. CD200 mostly supports tumor growth and invasion, by suppressing anti-tumor immune responses, while it is also known to inhibit melanoma cells from forming tumors or metastasizing into the lung. CD200 is considered as a biomarker in colon cancer and cutaneous squamous cell carcinoma. Deficiency of CD200 results in hyperactivation of macrophages and enhanced immune response to autoimmune disease.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86190.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A Truncated form of CD200 (CD200S) Expressed on Glioma Cells Prolonged Survival in a Rat Glioma Model by Induction of a Dendritic Cell-Like Phenotype in Tumor-Associated Macrophages.
Kobayashi K
Neoplasia, 18(4), 229-241 (2016)
Differential expression of CD200 in B-cell neoplasms by flow cytometry can assist in diagnosis, subclassification, and bone marrow staging.
Challagundla P
American Journal of Clinical Pathology, 142(6), 837-844 (2014)
Over-Expression of CD200 Predicts Poor Prognosis in Cutaneous Squamous Cell Carcinoma.
Li L
Medical Science Monitor : International Medical Journal of Experimental and Clinical Research, 22, 1079-1084 (2016)
Identification of CD200+ colorectal cancer stem cells and their gene expression profile.
Zhang SS
Oncology Reports, 36(4), 2252-2260 (2016)
Tumor-derived vaccines containing CD200 inhibit immune activation: implications for immunotherapy.
Xiong Z
Immunotherapy, 8(9), 1059-1071 (2016)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service