AV53716

Anti-ISYNA1 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-Myo-inositol 1-phosphate synthase A1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 61 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_057452
• UniProt accession no.: Q9NPH2
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ISYNA1(51477)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human ISYNA1

Application

Anti-ISYNA1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

ISYNA1 (inositol-3-phosphate synthase 1) gene encodes a protein that belongs to myo-inositol 1-phosphate synthase family and is predominantly expressed in testis, ovary, heart, placenta and pancreas. It is a crucial enzyme in myo-inositol biosynthesis pathway that plays a pivotal role in catalyzing the rate-limiting conversion of glucose 6-phosphate to myoinositol 1-phosphate.

Sequence

Synthetic peptide located within the following region: LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable