AV36848

Anti-ESX1 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 35 kDa
• species reactivity: mouse, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_031983
• UniProt accession no.: O54817
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: mouse ... ESX1(13984)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of mouse ESX1

Biochem/physiol Actions

ESX1 is a homeobox gene related to the mouse Esx1 homeobox gene. ESX1 is expressed during all stages of placental development and is localized to sparse areas of trophoblast in terminal villi in association with cytotrophoblastic cells. Proteolytic processing of ESX1 plays a role in concerted regulation of the cell cycle and transcription in human cells.

Sequence

Synthetic peptide located within the following region: MESHKKCPCCYCTDLKTFVGAVKEETLQDPQPSLSSTLLEGADYQENAES

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable