SAB2108746

Anti-MLKL

affinity isolated antibody

• Sinónimos: Anti-FLJ34389
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 54 kDa
• reactividad de especies: human
• concentración: 0.5-1 mg/mL
• técnicas: immunoblotting: suitable
• nº de acceso: NM_152649
• Nº de acceso UniProt: Q8NB16
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MLKL(197259)

Descripción

Descripción general

Mixed lineage kinase domain-like protein (MLKL) is encoded by the gene mapped to human chromosome 16q23. Activated MLKL is localized on the cell membrane.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human MLKL

Acciones bioquímicas o fisiológicas

Mixed lineage kinase domain-like protein (MLKL) primarily causes receptor-interacting protein (RIP) kinase–dependent necroptosis. However, during hepatitis, it results in programmed hepatocellular necrosis which is independent of RIPK3.s MLKL also participates in endosomal trafficking and in the formation of extracellular vesicles.

Secuencia

Synthetic peptide located within the following region: DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable