Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

SAB2108655

Sigma-Aldrich

Anti-Choline Acetyltransferase Antibody

rabbit polyclonal

Sinónimos:

Anti- CHOACTASE, Anti- CMS1A2, Anti-CMS1A

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

Nombre del producto

Anti-CHAT, affinity isolated antibody

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

70 kDa

reactividad de especies

dog, human, horse

concentración

0.5-1 mg/mL

técnicas

immunoblotting: suitable

nº de acceso

NM_020984

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CHAT(1103)

Descripción general

The previously assigned protein identifier A2BDF5 has been merged into P28329. Full details can be found on the UniProt database.

Inmunógeno

The immunogen for Anti-CHAT antibody: synthetic peptide directed towards the C terminal of human CHAT

Acciones bioquímicas o fisiológicas

CHAT is an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This protein is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer disease. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform.

Secuencia

Synthetic peptide located within the following region: SSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPS

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico